Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGNBP1 Rabbit Polyclonal Antibody (HRP)

GGNBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GGNBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEDSSFKLCVPGIVALQSPPNKAFRSTDTVGFLESELKKLLGMQQESRLW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

AAR26430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL
BNC472178-500 1x 500 µL

DMC1 (2H12/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTGES2 (NM_025072) Human Over-expression Lysate
LC403045 20 µg

PTGES2 (NM_025072) Human Over-expression Lysate

Sign In for Pricing
View Details
CCR7 (NM_001301717) Human Tagged ORF Clone
RG237806 10 µg

CCR7 (NM_001301717) Human Tagged ORF Clone

Sign In for Pricing
View Details
Spatc1 Mouse Gene Knockout Kit (CRISPR)
KN516566 1 Kit

Spatc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG 2c,  15nm
GAF-403-15 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG 2c, 15nm

Sign In for Pricing
View Details
4921536K21Rik Mouse Gene Knockout Kit (CRISPR)
KN500347 1 Kit

4921536K21Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details