Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM4 Rabbit Polyclonal Antibody (HRP)

CADM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NECL4, TSLL2, IGSF4C, Necl-4, synCAM4

UniProt

Q8NFZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CADM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660339

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMOC2 Antibody
A46565-50UL 50 μL

SMOC2 Antibody

Sign In for Pricing
View Details
Rabbit Bovine Nucleoside monophosphate kinase Antibody
orb20921 10 mg

Rabbit Bovine Nucleoside monophosphate kinase Antibody

Sign In for Pricing
View Details
CST6 CytoSection
TS407689P5 25 Slides

CST6 CytoSection

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (FITC)
MBS6416456-01 0.1 mL

ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (FITC)

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (FITC)
MBS6416456-02 5x 0.1 mL

ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (FITC)

Sign In for Pricing
View Details
Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3050002 1.0 µg DNA

Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details