Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf40A Rabbit Polyclonal Antibody (HRP)

CXorf40A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CXorf40, CXorf40A

UniProt

Q8TE69

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXorf40A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CytoTell® Red 590
22261-AAT 500 Tests

CytoTell® Red 590

Sign In for Pricing
View Details
ENaC beta Antibody: ATTO 488
SMC-241D-A488 100 µg

ENaC beta Antibody: ATTO 488

Sign In for Pricing
View Details
Lgals3 Mouse Gene Knockout Kit (CRISPR)
KN309243 1 Kit

Lgals3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
hnRNP G (RBMX) (NM_002139) Human Over-expression Lysate
LC419511 20 µg

hnRNP G (RBMX) (NM_002139) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF433 activation kit by CRISPRa
GA116073 1 Kit

Human ZNF433 activation kit by CRISPRa

Sign In for Pricing
View Details
Try5 Mouse Gene Knockout Kit (CRISPR)
KN518318 1 Kit

Try5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details