Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA10 Rabbit Polyclonal Antibody (Biotin)

EPHA10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q5JZY3

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NLLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCALTTCPRPPT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

NCBI Accession Number

NP_001092909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBZ (Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-Globin) (MaxLight 650)
MBS6419915-01 0.1 mL

HBZ (Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-Globin) (MaxLight 650)

Sign In for Pricing
View Details
HBZ (Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-Globin) (MaxLight 650)
MBS6419915-02 5x 0.1 mL

HBZ (Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-Globin) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal Lgi4 Antibody [DyLight 405]
NBP1-76381V 0.1 mL

Rabbit Polyclonal Lgi4 Antibody [DyLight 405]

Sign In for Pricing
View Details
Verotoxin II (Shiga-like) A subunit (SLT-2a, STX-2a) (MaxLight 405) discontinued
171811-ML405 100 µL

Verotoxin II (Shiga-like) A subunit (SLT-2a, STX-2a) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DGKA antibody
10R-3826 100 µL

DGKA antibody

Sign In for Pricing
View Details
Tyrosinase (243-251) (human)
5-02046 4x 5 mg

Tyrosinase (243-251) (human)

Sign In for Pricing
View Details