Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR6 Rabbit Polyclonal Antibody (HRP)

LPAR6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LAH3, P2Y5, ARWH1, HYPT8, LPA-6, P2RY5

UniProt

P43657

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPAR6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005758

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC1 Human Gene Knockout Kit (CRISPR)
KN208602 1 Kit

GPC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1963), CF405S conjugate, 0.1mg/mL
BNC041963-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1963), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat IgG (Fcγ Fragment specific), AlpSdAbs® VHH
HA710285 100 µg

Rat IgG (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI3D7]
CF808375 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Crotonobetaine Hydrochloride-d9
TRC-C818802-5MG 5 mg

Crotonobetaine Hydrochloride-d9

Sign In for Pricing
View Details
NXPH1 Rabbit Polyclonal Antibody
AP32310PU-N 50 µL

NXPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details