Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN2A Rabbit Polyclonal Antibody (FITC)

SPIN2A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DXF34, SPIN2, TDRD25, dJ323P24.1

UniProt

Q99865

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPIN2A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTKKKVSQKKQRGRPSSQPCRNIVGCRISHGWKEGDEPITQWKGTVLDQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAA70988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human UNC119B sgRNA gene knockout kit - Lentiviral human UNC119B sgRNA gene knockout kit (25)
GTR15365781 1 Vial

Lentiviral human UNC119B sgRNA gene knockout kit - Lentiviral human UNC119B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
GRB10 (Growth Factor Receptor-bound Protein 10, GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS) (Biotin)
MBS6419150-01 0.1 mL

GRB10 (Growth Factor Receptor-bound Protein 10, GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS) (Biotin)

Sign In for Pricing
View Details
GRB10 (Growth Factor Receptor-bound Protein 10, GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS) (Biotin)
MBS6419150-02 5x 0.1 mL

GRB10 (Growth Factor Receptor-bound Protein 10, GRB-IR, Grb-10, IRBP, KIAA0207, MEG1, RSS) (Biotin)

Sign In for Pricing
View Details
At1g52710 Antibody
orb786630 2 mg

At1g52710 Antibody

Sign In for Pricing
View Details
Barium Disodium Ethylenediaminetetraacetate
IN13153 25 g

Barium Disodium Ethylenediaminetetraacetate

Sign In for Pricing
View Details
LLP Antibody
orb791543 2 mg

LLP Antibody

Sign In for Pricing
View Details