Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED2 Rabbit Polyclonal Antibody (HRP)

TMED2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P24, P24A, RNP24, p24b1, p24beta1

UniProt

Q15363

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TMED2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006806

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cecr5 (Hdhd5) (NM_144815) Mouse Tagged ORF Clone Lentiviral Particle
MR206651L4V 200 µL

Cecr5 (Hdhd5) (NM_144815) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
c Fos (FOS) (NM_005252) Human Tagged ORF Clone Lentiviral Particle
RC202597L2V 200 µL

c Fos (FOS) (NM_005252) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PIP5K3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2479195 100 µL

PIP5K3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Mouse Gbe1 Pre-designed siRNA Set A
SI105315A 1 Each

Mouse Gbe1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Glycated Albumin
MBS355730 Inquire

Glycated Albumin

Sign In for Pricing
View Details
O,O-Diethyl Thiophosphate Sodium Salt
TRC-D445125-2.5G 2.5 g

O,O-Diethyl Thiophosphate Sodium Salt

Sign In for Pricing
View Details