Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL3 Rabbit Polyclonal Antibody (Biotin)

APOL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CG121, CG12_1, APOLIII, apoL-III

UniProt

O95236

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human APOL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_663615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF44 (Zinc Finger Protein 44, Gonadotropin-inducible Ovary Transcription Repressor 2, GIOT2, GIOT-2, KOX7, Zinc Finger Protein 55, ZNF55, Zinc Finger Protein 58, ZNF58, Zinc Finger Protein KOX7) (MaxLight 405) discontinued
135736-ML405 100 µL

ZNF44 (Zinc Finger Protein 44, Gonadotropin-inducible Ovary Transcription Repressor 2, GIOT2, GIOT-2, KOX7, Zinc Finger Protein 55, ZNF55, Zinc Finger Protein 58, ZNF58, Zinc Finger Protein KOX7) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RPL32P28 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV780009 1.0 µg DNA

RPL32P28 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
POMT1 Antibody (C-term) Blocking peptide
MBS9219078-01 0.5 mg

POMT1 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
POMT1 Antibody (C-term) Blocking peptide
MBS9219078-02 5x 0.5 mg

POMT1 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-550a-5p Vector
mh31006 500 ng

LentimiRa-Off-hsa-miR-550a-5p Vector

Sign In for Pricing
View Details
Mouse RNA polymerase II-associated factor 1 homolog, PAF1 ELISA Kit
MBS9331903-01 48 Well

Mouse RNA polymerase II-associated factor 1 homolog, PAF1 ELISA Kit

Sign In for Pricing
View Details