Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL4L Rabbit Polyclonal Antibody (FITC)

NOL4L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C20orf112, C20orf113

UniProt

Q96MY1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C20orf112

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRVMNSQEQDETSVSSEDFDMSDSTWMSADPHLASSLSPSQDERMRSPQN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001243727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Pneumoniae scpB Protein (aa 1-208)
VAng-Lsx05213-500gEcoli 500 µg (E. coli)

Recombinant Mycoplasma Pneumoniae scpB Protein (aa 1-208)

Sign In for Pricing
View Details
P/P069/NT/PE-DIA25-250 Prohibited Activity Signs & Labels (Adhesive)
310085 250 Pack (250 Panel (s) x 1 Roll)

P/P069/NT/PE-DIA25-250 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details
MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (MaxLight 405) discontinued
129617-ML405 100 µL

MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human LDB1 Protein, N-His
YHJ15501 100 μg

Recombinant Human LDB1 Protein, N-His

Sign In for Pricing
View Details
Mouse Monoclonal CD3 gamma Antibody (5B7B2)
NBP2-61729 0.1 mL

Mouse Monoclonal CD3 gamma Antibody (5B7B2)

Sign In for Pricing
View Details
NR2E1/TLX Rabbit pAb
A7455-01 20 µL

NR2E1/TLX Rabbit pAb

Sign In for Pricing
View Details