Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS3 Rabbit Polyclonal Antibody (HRP)

HAUS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IT1, dgt3, C4orf15

UniProt

Q68CZ6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HAUS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_078787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit
MBS9346420-01 48 Well

Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit

Sign In for Pricing
View Details
Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit
MBS9346420-02 96 Well

Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit

Sign In for Pricing
View Details
Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit
MBS9346420-03 5x 96 Well

Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit

Sign In for Pricing
View Details
Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit
MBS9346420-04 10x 96 Well

Sheep Transient Receptor Potential Cation Channel Subfamily V, Member 4 (TRPV4) ELISA Kit

Sign In for Pricing
View Details
ETFB Rabbit pAb
E47R3937 100 µL

ETFB Rabbit pAb

Sign In for Pricing
View Details
Arhgap30 (NM_001109077) Rat Tagged ORF Clone
RR214833 10 µg

Arhgap30 (NM_001109077) Rat Tagged ORF Clone

Sign In for Pricing
View Details