Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB11 Rabbit Polyclonal Antibody (FITC)

HSPB11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PP25, IFT25, FAP232, C1orf41, HSPCO34

UniProt

Q9Y547

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSPB11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057210

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Shf shRNA (UAS) - Lentiviral mouse Shf shRNA (UAS, iRFP) (25)
GTR15182858 1 Vial

Lentiviral mouse Shf shRNA (UAS) - Lentiviral mouse Shf shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
MEK1 2 (Phospho-Ser218 + Ser222) Antibody HRP Conjugated
orb1542415 100 µL

MEK1 2 (Phospho-Ser218 + Ser222) Antibody HRP Conjugated

Sign In for Pricing
View Details
General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit
MBS2162089-01 24 Strip Well

General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit

Sign In for Pricing
View Details
General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit
MBS2162089-02 48 Well

General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit

Sign In for Pricing
View Details
General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit
MBS2162089-03 96 Well

General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit

Sign In for Pricing
View Details
General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit
MBS2162089-04 5x 96 Well

General Anti-Teduglutide Antibody (Anti-TFA) ELISA Kit

Sign In for Pricing
View Details