Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA5 Rabbit Polyclonal Antibody (HRP)

LILRA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD85, LIR9, CD85F, ILT11, LIR-9, ILT-11, LILRB7

UniProt

A6NI73

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LILRA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_870994

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M71-88-427 AF Systems Consumables
114994 Box of 250 Label(s)

M71-88-427 AF Systems Consumables

Sign In for Pricing
View Details
SHMT2 Conjugated Antibody
C32233 100 µL

SHMT2 Conjugated Antibody

Sign In for Pricing
View Details
TERT Adenovirus (Rat)
46506056 1.0 mL

TERT Adenovirus (Rat)

Sign In for Pricing
View Details
Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RD-ALOXE3-Hu-01 96 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details
Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit
RD-ALOXE3-Hu-02 48 Tests

Human Arachidonate Lipoxygenase 3 (ALOXE3) ELISA Kit

Sign In for Pricing
View Details
Cpsf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K5008107 1.0 µg DNA

Cpsf2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details