Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA5 Rabbit Polyclonal Antibody (HRP)

LILRA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD85, LIR9, CD85F, ILT11, LIR-9, ILT-11, LILRB7

UniProt

A6NI73

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LILRA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_870994

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF8/TBN Rabbit Polyclonal Antibody (Fluoro488)
orb3095563 100 µg

TAF8/TBN Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
ACP5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6434R-BF350-TR 20 µL

ACP5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (Biotin)
MBS6279123-01 0.2 mL

BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (Biotin)

Sign In for Pricing
View Details
BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (Biotin)
MBS6279123-02 5x 0.2 mL

BTBD17, CT (BTBD17, BTB/POZ domain-containing protein 17, Galectin-3-binding protein-like) (Biotin)

Sign In for Pricing
View Details
LRP-2 (Megalin)
051959 100 µg

LRP-2 (Megalin)

Sign In for Pricing
View Details
RNASET2 Protein Vector (Rat) (pPB-N-His)
PV301687 500 ng

RNASET2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details