Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASL11A Rabbit Polyclonal Antibody (HRP)

RASL11A Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6T310

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASL11A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDTPGGVQIQD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996563

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Angiopoietin related protein 6 (ANGPTL6) ELISA Kit
GTR10351720 96 Well

Bovine Angiopoietin related protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Recombinant Cat Allergen Fel d 4 Protein, His-SUMO, E.coli-500ug
QP7729-ec-500ug 500ug

Recombinant Cat Allergen Fel d 4 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
ICAM1 Monoclonal Antibody
TA399291 100 µg

ICAM1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ASFV Pret-067 Protein (aa 1-60)
VAng-2358Lsx-50g 50 µg

Recombinant ASFV Pret-067 Protein (aa 1-60)

Sign In for Pricing
View Details
RRAGC (NM_022157) Human Tagged Lenti ORF Clone
RC203834L3 10 µg

RRAGC (NM_022157) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PIK3CA Antibody (R3K76)
RHE35201 100 μg

Anti-PIK3CA Antibody (R3K76)

Sign In for Pricing
View Details