Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLEC10 Rabbit Polyclonal Antibody (HRP)

COLEC10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

3MC3, CLL1, CL-34

UniProt

Q9Y6Z7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COLEC10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human POGLUT2 shRNA (UAS) - Lentiviral human POGLUT2 shRNA (UAS, GFP) (100)
GTR15130713 1 Vial

Lentiviral human POGLUT2 shRNA (UAS) - Lentiviral human POGLUT2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse Anti-Chicken Osteocalcin Monoclonal Antibody
VD11N24 1 Each

Mouse Anti-Chicken Osteocalcin Monoclonal Antibody

Sign In for Pricing
View Details
INgezim Paratuberculosis
12.PTB.K.1/5 480 tests (5X 96 wells plate)

INgezim Paratuberculosis

Sign In for Pricing
View Details
Rabbit Polyclonal WAC Antibody [DyLight 488]
NBP2-82057G 0.1 mL

Rabbit Polyclonal WAC Antibody [DyLight 488]

Sign In for Pricing
View Details
Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [HRP]
NBP2-11785H 0.1 mL

Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [HRP]

Sign In for Pricing
View Details
Anti-HDLBP Antibody Picoband®, Dylight550 Conjugate
A06727-2-Dylight550 100 µg

Anti-HDLBP Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details