Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx30 Rabbit Polyclonal Antibody (FITC)

Snx30 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4732481H14Rik, C030041J06Rik

UniProt

Q8CE50

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Snx30

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dodecaonium Bromide
TRC-D358080-500MG 500 mg

Dodecaonium Bromide

Sign In for Pricing
View Details
ZAP70, ID (ZAP70, SRK, Tyrosine-protein kinase ZAP-70, 70kD zeta-chain associated protein, Syk-related tyrosine kinase) (MaxLight 405) discontinued
043983-ML405 100 µL

ZAP70, ID (ZAP70, SRK, Tyrosine-protein kinase ZAP-70, 70kD zeta-chain associated protein, Syk-related tyrosine kinase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Contact Slide 2
525272 20/Pack

Contact Slide 2

Sign In for Pricing
View Details
FOXP1 Blocking Peptide
MBS9619764-01 1 mg

FOXP1 Blocking Peptide

Sign In for Pricing
View Details
FOXP1 Blocking Peptide
MBS9619764-02 5x 1 mg

FOXP1 Blocking Peptide

Sign In for Pricing
View Details
MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (MaxLight 405)
MBS6191269-01 0.1 mL

MCAT (MT, Malonyl-CoA-acyl Carrier Protein Transacylase, Mitochondrial, Mitochondrial Malonyl CoA:ACP Acyltransferase, Mitochondrial Malonyltransferase, [Acyl-carrier-protein] Malonyltransferase) (MaxLight 405)

Sign In for Pricing
View Details