Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD33 Rabbit Polyclonal Antibody (FITC)

ANKRD33 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PANKY, C12orf7

UniProt

Q7Z3H0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD33

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_872414

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BIN1 ELISA Kit (Colorimetric)
NBP3-27256 1 Kit

Human BIN1 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)
MBS6177098-01 0.1 mL

AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)

Sign In for Pricing
View Details
AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)
MBS6177098-02 5x 0.1 mL

AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)

Sign In for Pricing
View Details
Alpha Fetoprotein Antibody, mAb, Rabbit
A03519-100 100 µL

Alpha Fetoprotein Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI16H2]
TA805110BM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI16H2]

Sign In for Pricing
View Details
Rabbit Anti-red cell antibody ELISA Kit
MBS733220-01 48 Well

Rabbit Anti-red cell antibody ELISA Kit

Sign In for Pricing
View Details