Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1 Rabbit Polyclonal Antibody (HRP)

BTN3A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTF5, BT3.1, CD277, BTN3.1

UniProt

O00481

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTN3A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine cell division cycle (CDC) ELISA Kit
MBS2608929-01 48 Well

Bovine cell division cycle (CDC) ELISA Kit

Sign In for Pricing
View Details
Bovine cell division cycle (CDC) ELISA Kit
MBS2608929-02 96 Well

Bovine cell division cycle (CDC) ELISA Kit

Sign In for Pricing
View Details
Bovine cell division cycle (CDC) ELISA Kit
MBS2608929-03 5x 96 Well

Bovine cell division cycle (CDC) ELISA Kit

Sign In for Pricing
View Details
Bovine cell division cycle (CDC) ELISA Kit
MBS2608929-04 10x 96 Well

Bovine cell division cycle (CDC) ELISA Kit

Sign In for Pricing
View Details
LIM Homeobox Transcription Factor 1 Beta (LMX1B) Antibody
abx006624-01 60 µL

LIM Homeobox Transcription Factor 1 Beta (LMX1B) Antibody

Sign In for Pricing
View Details
LIM Homeobox Transcription Factor 1 Beta (LMX1B) Antibody
abx006624-02 120 µL

LIM Homeobox Transcription Factor 1 Beta (LMX1B) Antibody

Sign In for Pricing
View Details