Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM50A Rabbit Polyclonal Antibody (Biotin)

FAM50A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

9F, XAP5, HXC26, MRXSA, HXC-26, DXS9928E

UniProt

Q14320

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM50A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r151 Double Nickase Plasmid (m)
sc-436724-NIC 20 µg

Vmn1r151 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ERBB1 / EGFR / HER1 Reference Antibody (Laprituximab emtansine)
orb1818115 100 µg

ERBB1 / EGFR / HER1 Reference Antibody (Laprituximab emtansine)

Sign In for Pricing
View Details
Prpf18 3'UTR Lenti-reporter-Luc Vector
37754086 1.0 µg

Prpf18 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olfr603 Mouse shRNA Lentiviral Particle (Locus ID 259073)
TL508001V 500 µL Each

Olfr603 Mouse shRNA Lentiviral Particle (Locus ID 259073)

Sign In for Pricing
View Details
Succinimide 99% For Synthesis
257800100 100 mg

Succinimide 99% For Synthesis

Sign In for Pricing
View Details
ATP7B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-1718R-BF488-TR 20 µL

ATP7B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details