Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL2 Rabbit Polyclonal Antibody (FITC)

HHIPL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA1822L

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HHIPL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGKCKYKPVPVRTKSKRIPFRPLAKTVLDLLKEQSEKAARKSSSATLASG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079022

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat AMP Deaminase 2 (AMPD2) ELISA Kit
abx501656 96 Tests

Rat AMP Deaminase 2 (AMPD2) ELISA Kit

Sign In for Pricing
View Details
TMC8 CRISPR Knock Out 293T Cell Line (Human)
46822141 1x 10^6 Cells / 1.0 mL

TMC8 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Human TNFRSF3/TNFR-III/LTBR Protein
RP01179-01 10 μg

Recombinant Human TNFRSF3/TNFR-III/LTBR Protein

Sign In for Pricing
View Details
Recombinant Human TNFRSF3/TNFR-III/LTBR Protein
RP01179-02 20 μg

Recombinant Human TNFRSF3/TNFR-III/LTBR Protein

Sign In for Pricing
View Details
Recombinant Human TNFRSF3/TNFR-III/LTBR Protein
RP01179-03 50 μg

Recombinant Human TNFRSF3/TNFR-III/LTBR Protein

Sign In for Pricing
View Details
Recombinant Human TNFRSF3/TNFR-III/LTBR Protein
RP01179-04 100 μg

Recombinant Human TNFRSF3/TNFR-III/LTBR Protein

Sign In for Pricing
View Details