Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP27 Rabbit Polyclonal Antibody (FITC)

MMP27 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MMP-27

UniProt

Q9H306

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MMP27

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071405

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUPR1 Polyclonal Conjugated Antibody
C30333 100 µL

NUPR1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Melanocortin-2 Receptor accessory protein (MRAP) Human ELISA Kit
E9171 96 Tests

Melanocortin-2 Receptor accessory protein (MRAP) Human ELISA Kit

Sign In for Pricing
View Details
ACCN4, NT (ASIC4, ACCN4, Acid-sensing ion channel 4, Amiloride-sensitive cation channel 4, Amiloride-sensitive cation channel 4, pituitary) (MaxLight 405) discontinued
031530-ML405 100 µL

ACCN4, NT (ASIC4, ACCN4, Acid-sensing ion channel 4, Amiloride-sensitive cation channel 4, Amiloride-sensitive cation channel 4, pituitary) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Nori Rabbit ALT ELISA Kit
GR144306 96 Well

Nori Rabbit ALT ELISA Kit

Sign In for Pricing
View Details
HMGA1 (NM_145903) Human Tagged ORF Clone Lentiviral Particle
RC204972L4V 200 µL

HMGA1 (NM_145903) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FEB6 Protein Vector (Human) (pPB-N-His)
PV078214 500 ng

FEB6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details