Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR3A1 Rabbit Polyclonal Antibody (Biotin)

OR3A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR40, OLFRA03, OR17-40, OR17-82

UniProt

P47881

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1) (APC)
124514-APC 100 µL

CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1) (APC)

Sign In for Pricing
View Details
Chicken measles virus antibody ELISA KIT
JOT-EKD0031Ch 96 wells

Chicken measles virus antibody ELISA KIT

Sign In for Pricing
View Details
Recombinant Pongo abelii Zinc transporter ZIP6 (SLC39A6)
orb2908508-01 20 µg

Recombinant Pongo abelii Zinc transporter ZIP6 (SLC39A6)

Sign In for Pricing
View Details
Recombinant Pongo abelii Zinc transporter ZIP6 (SLC39A6)
orb2908508-02 100 µg

Recombinant Pongo abelii Zinc transporter ZIP6 (SLC39A6)

Sign In for Pricing
View Details
Rat Stathmin (STMN1) ELISA Kit
MBS2804361-01 48 Tests

Rat Stathmin (STMN1) ELISA Kit

Sign In for Pricing
View Details
Rat Stathmin (STMN1) ELISA Kit
MBS2804361-02 96 Tests

Rat Stathmin (STMN1) ELISA Kit

Sign In for Pricing
View Details