Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSGEPL1 Rabbit Polyclonal Antibody (FITC)

OSGEPL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Qri7, OSGEPL

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OSGEPL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fast Plus EvaGreen® Master Mix for qPCR with high Rox (200 rxn)
#31015 2x 1 mL

Fast Plus EvaGreen® Master Mix for qPCR with high Rox (200 rxn)

Sign In for Pricing
View Details
Human NAF1 activation kit by CRISPRa
GA114209 1 Kit

Human NAF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Mago nashi homolog 2 (MAGOHB) activation kit by CRISPRa
GA110522 1 Kit

Human Mago nashi homolog 2 (MAGOHB) activation kit by CRISPRa

Sign In for Pricing
View Details
Rust Prevention Tester BPTL-208
BPTL-208 1 Unit

Rust Prevention Tester BPTL-208

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714056 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
2-Hydroxy-5-iodobenzoic acid
TRC-H943630-50G 50 g

2-Hydroxy-5-iodobenzoic acid

Sign In for Pricing
View Details