Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH4A Rabbit Polyclonal Antibody (Biotin)

RSPH4A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RSHL3, CILD11, RSPH6B, dJ412I7.1

UniProt

Q5TD94

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSPH4A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPHHTSQSEGNTFQQSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FLNC Antibody [Biotin]
NBP2-79816B 0.1 mL

Rabbit Polyclonal FLNC Antibody [Biotin]

Sign In for Pricing
View Details
NR1D1, ID (NR1D1, EAR1, HREV, THRAL, Nuclear receptor subfamily 1 group D member 1, Rev-erbA-alpha, V-erbA-related protein 1) (APC)
MBS6326480-01 0.2 mL

NR1D1, ID (NR1D1, EAR1, HREV, THRAL, Nuclear receptor subfamily 1 group D member 1, Rev-erbA-alpha, V-erbA-related protein 1) (APC)

Sign In for Pricing
View Details
NR1D1, ID (NR1D1, EAR1, HREV, THRAL, Nuclear receptor subfamily 1 group D member 1, Rev-erbA-alpha, V-erbA-related protein 1) (APC)
MBS6326480-02 5x 0.2 mL

NR1D1, ID (NR1D1, EAR1, HREV, THRAL, Nuclear receptor subfamily 1 group D member 1, Rev-erbA-alpha, V-erbA-related protein 1) (APC)

Sign In for Pricing
View Details
CD34 Polyclonal Antibody, HRP Conjugated
bs-0646R-HRP-01 20 µL

CD34 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CD34 Polyclonal Antibody, HRP Conjugated
bs-0646R-HRP-02 100 µL

CD34 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human Disintegrin and metalloproteinase domain-containing protein 28 ELISA Kit
MBS765726-01 48 Well

Human Disintegrin and metalloproteinase domain-containing protein 28 ELISA Kit

Sign In for Pricing
View Details