Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS9 Rabbit Polyclonal Antibody (HRP)

TMPRSS9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z410

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPRSS9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_892018

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 Mouse Monoclonal Antibody [Clone ID: AV7]
AM08121FC-N 500 µg

CD28 Mouse Monoclonal Antibody [Clone ID: AV7]

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF647 conjugate, 0.1mg/mL
BNC470142-100 1x 100 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nkx2.6 (NKX2-6) (NM_001136271) Human Over-expression Lysate
LC427879 20 µg

Nkx2.6 (NKX2-6) (NM_001136271) Human Over-expression Lysate

Sign In for Pricing
View Details
PHLPP2 (NM_015020) Human Recombinant Protein
TP312846L 1 mg

PHLPP2 (NM_015020) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn1r203 Mouse Gene Knockout Kit (CRISPR)
KN518996 1 Kit

Vmn1r203 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-404
BCPS-404 1 Unit

Large Capacity Water Purification System BCPS-404

Sign In for Pricing
View Details