Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yod1 Rabbit Polyclonal Antibody (HRP)

Yod1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hshin7, 6330564D18Rik, 9930028C20Rik

UniProt

Q8CB27

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Yod1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848806

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SON sgRNA CRISPR Lentivector set (Human)
K2258401 3x 1.0 µg

SON sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Anti-MEIOB Antibody Picoband® Fluoro594 Conjugated
A13211-2-Fluoro594 100 µg/Vial

Anti-MEIOB Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Human EIF2AK2 knockdown cell line
ABC-KD4690 1 Vial

Human EIF2AK2 knockdown cell line

Sign In for Pricing
View Details
Monkey Interleukin 4 (IL4) ELISA Kit
MBS456558-01 48 Tests

Monkey Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
Monkey Interleukin 4 (IL4) ELISA Kit
MBS456558-02 96 Tests

Monkey Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
Monkey Interleukin 4 (IL4) ELISA Kit
MBS456558-03 5x 96 Tests

Monkey Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details