Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2A Rabbit Polyclonal Antibody (HRP)

ACSM2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACSM2, A-923A4.1

UniProt

Q08AH3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACSM2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 550)
125166-ML550 100 µL

COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 550)

Sign In for Pricing
View Details
UBXD4 siRNA (h)
sc-94677 10 µM

UBXD4 siRNA (h)

Sign In for Pricing
View Details
Lrrc19 Rat shRNA Lentiviral Particle (Locus ID 680478)
TL707906V 500 µL Each

Lrrc19 Rat shRNA Lentiviral Particle (Locus ID 680478)

Sign In for Pricing
View Details
Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Over-expression Lysate
E45H07383-2 20 µg

Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lactoperoxidase (LPO)
MBS2141801-01 0.1 mL

HRP-Linked Polyclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Lactoperoxidase (LPO)
MBS2141801-02 0.2 mL

HRP-Linked Polyclonal Antibody to Lactoperoxidase (LPO)

Sign In for Pricing
View Details