Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2 Rabbit Polyclonal Antibody (Biotin)

BZW2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

5MP1, MST017, HSPC028, MSTP017

UniProt

Q9Y6E2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BZW2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054757

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit
MBS9916419 Inquire

Goose Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)
MBS2154220-01 0.01 mg

Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)

Sign In for Pricing
View Details
Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)
MBS2154220-02 0.05 mg

Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)

Sign In for Pricing
View Details
Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)
MBS2154220-03 0.1 mg

Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)

Sign In for Pricing
View Details
Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)
MBS2154220-04 0.2 mg

Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)

Sign In for Pricing
View Details
Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)
MBS2154220-05 0.5 mg

Recombinant Wingless Type MMTV Integration Site Family, Member 10B (WNT10B)

Sign In for Pricing
View Details