Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEFM Rabbit Polyclonal Antibody (HRP)

TEFM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C17orf42

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEFM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLESLMNVPLFKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_078959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr402 3'UTR Lenti-reporter-Luc Vector
34375086 1.0 µg

Olr402 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Picrolonic Acid for Synthesis
191765-01 1 g

Picrolonic Acid for Synthesis

Sign In for Pricing
View Details
Picrolonic Acid for Synthesis
191765-02 5 g

Picrolonic Acid for Synthesis

Sign In for Pricing
View Details
Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Janelia Fluor 549]
NB100-529JF549 0.1 mL

Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Rat Acetyl-CoA (ACA) ELISA Kit
EK8715 48 Tests

Rat Acetyl-CoA (ACA) ELISA Kit

Sign In for Pricing
View Details
SOD1 aa 58-72 | Superoxide dismutase 1, soluble (clone number 15,13) Antibody
orb303294 50 µg

SOD1 aa 58-72 | Superoxide dismutase 1, soluble (clone number 15,13) Antibody

Sign In for Pricing
View Details