Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTNBP2NL Rabbit Polyclonal Antibody (HRP)

CTTNBP2NL Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9P2B4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTTNBP2NL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCT14 Polyclonal Antibody
orb1413142 100 µL

MCT14 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal beta-Catenin Antibody (OTI2F10) [Janelia Fluor 549]
NBP2-70511JF549 0.1 mL

Mouse Monoclonal beta-Catenin Antibody (OTI2F10) [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal Fibronectin Antibody (568) [Alexa Fluor 405]
NBP2-48018AF405 0.1 mL

Mouse Monoclonal Fibronectin Antibody (568) [Alexa Fluor 405]

Sign In for Pricing
View Details
TRNAK13 Protein Vector (Human) (pPM-C-HA)
PV139112 500 ng

TRNAK13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoamine oxidase A ELISA kit
GTR10474247 96 Well

Mouse Monoamine oxidase A ELISA kit

Sign In for Pricing
View Details
Recombinant Tropheryma whipplei Cysteine--tRNA ligase 1 (cysS1)
MBS1410292-01 0.02 mg (E-Coli)

Recombinant Tropheryma whipplei Cysteine--tRNA ligase 1 (cysS1)

Sign In for Pricing
View Details