Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTNBP2NL Rabbit Polyclonal Antibody (HRP)

CTTNBP2NL Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9P2B4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTTNBP2NL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complete Medium for Rat Bone Marrow Maturation Dendritic Cells
abx704521-01 100 mL

Complete Medium for Rat Bone Marrow Maturation Dendritic Cells

Sign In for Pricing
View Details
Complete Medium for Rat Bone Marrow Maturation Dendritic Cells
abx704521-02 500 mL

Complete Medium for Rat Bone Marrow Maturation Dendritic Cells

Sign In for Pricing
View Details
KRT7 Antibody
MBS2519448-01 0.06 mL

KRT7 Antibody

Sign In for Pricing
View Details
KRT7 Antibody
MBS2519448-02 0.12 mL

KRT7 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal NOV/CCN3 Antibody (130) [Alexa Fluor 750]
NBP2-89369AF750 0.1 mL

Rabbit Monoclonal NOV/CCN3 Antibody (130) [Alexa Fluor 750]

Sign In for Pricing
View Details
NCAPH Rabbit pAb
E45R21692N 50 ul

NCAPH Rabbit pAb

Sign In for Pricing
View Details