Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS4L Rabbit Polyclonal Antibody (HRP)

DUS4L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DUS4, PP35

UniProt

O95620

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DUS4L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_853559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK (NM_013314) Human Over-expression Lysate
LS029760 100 µg

BLNK (NM_013314) Human Over-expression Lysate

Sign In for Pricing
View Details
CLUL1 Antibody
orb1561814-01 50 µL

CLUL1 Antibody

Sign In for Pricing
View Details
CLUL1 Antibody
orb1561814-02 100 µL

CLUL1 Antibody

Sign In for Pricing
View Details
CLUL1 Antibody
orb1561814-03 200 µL

CLUL1 Antibody

Sign In for Pricing
View Details
Recombinant Human Monocyte Chemotactic Protein-4/CCL13
P1465-.005 5 µg

Recombinant Human Monocyte Chemotactic Protein-4/CCL13

Sign In for Pricing
View Details
BMP-4 (BMP4, Bone Morphogenetic Protein 4, Bone Morphogenetic Protein 2B, BMP-2B, BMP2B, DVR4) discontinued
029731 100 µg

BMP-4 (BMP4, Bone Morphogenetic Protein 4, Bone Morphogenetic Protein 2B, BMP-2B, BMP2B, DVR4) discontinued

Sign In for Pricing
View Details