Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM40A Rabbit Polyclonal Antibody (FITC)

FAM40A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAM40A, FAR11A

UniProt

Q5VSL9

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEVT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEVT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_149079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA504020AM 100 µL

DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
GDF3 Rabbit Monoclonal Antibody
TA423818 100 µL

GDF3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF568 conjugate, 0.1mg/mL
BNC682557-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTC36 (NM_001080441) Human Over-expression Lysate
LC421658 20 µg

TTC36 (NM_001080441) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-UNEL-R0088-01 5x 96 Tests

Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-UNEL-R0088-02 15x 96 Tests

Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details