Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam110a Rabbit Polyclonal Antibody (HRP)

Fam110a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1308904

UniProt

Q6AXZ9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fam110a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD3 Protein Vector (Human) (pPB-N-His)
PV066458 500 ng

C2CD3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)
MBS2100099-01 5x 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)
MBS2100099-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)
MBS2100099-03 10x 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)
MBS2100099-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Tumor Necrosis Factor Receptor Superfamily, Member 5 (TNFRSF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
BRD1 rabbit pAb
E28PT6310 100 µL

BRD1 rabbit pAb

Sign In for Pricing
View Details