Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP6 Rabbit Polyclonal Antibody (FITC)

GBP6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZN66

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GBP6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_940862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38880114 3x 1.0 µg

Rfx2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit
YP-W31746-01 48 Tests

Rat Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit

Sign In for Pricing
View Details
Rat Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit
YP-W31746-02 96 Tests

Rat Acetyl Coenzyme A Carboxylase Alpha (ACACa) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human AGTR2 Monoclonal Clone FIO-1 100ug
IRBAHUAGTR2FIO1C100ug 100 µg

Rabbit Anti Human AGTR2 Monoclonal Clone FIO-1 100ug

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FH21A Polyclonal Antibody
MBS9000887 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FH21A Polyclonal Antibody

Sign In for Pricing
View Details
Guinea pig interleukin 27 p28 (IL-27 p28) ELISA Kit
EIA06551Gu 1 Kit

Guinea pig interleukin 27 p28 (IL-27 p28) ELISA Kit

Sign In for Pricing
View Details