Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR173 Rabbit Polyclonal Antibody (HRP)

GPR173 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SREB3

UniProt

Q9NS66

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR173

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Olfactory receptor 51A4 (OR51A4) ELISA kit
GTR10412499 96 Well

Monkey Olfactory receptor 51A4 (OR51A4) ELISA kit

Sign In for Pricing
View Details
NCAPG, NT (NCAPG, CAPG, NYMEL3, Condensin complex subunit 3, Chromosome-associated protein G, Condensin subunit CAP-G, Melanoma antigen NY-MEL-3, Non-SMC condensin I complex subunit G, XCAP-G homolog) (AP) discontinued
038822-AP 200 µL

NCAPG, NT (NCAPG, CAPG, NYMEL3, Condensin complex subunit 3, Chromosome-associated protein G, Condensin subunit CAP-G, Melanoma antigen NY-MEL-3, Non-SMC condensin I complex subunit G, XCAP-G homolog) (AP) discontinued

Sign In for Pricing
View Details
HMGB1 Rabbit monoclonal antibody
orb1677884-01 50 µL

HMGB1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
HMGB1 Rabbit monoclonal antibody
orb1677884-02 100 µL

HMGB1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
HMGB1 Rabbit monoclonal antibody
orb1677884-03 200 µL

HMGB1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
TnT Human - Human Cardiac Troponin-T Protein
OPPA01257-10UG 10 µg

TnT Human - Human Cardiac Troponin-T Protein

Sign In for Pricing
View Details