Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAGHL Rabbit Polyclonal Antibody (FITC)

HAGHL Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6PII5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAGHL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_115680

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade
PX-TA1535-01 50 µg

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Sign In for Pricing
View Details
Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade
PX-TA1535-02 100 µg

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Sign In for Pricing
View Details
Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade
PX-TA1535-03 1 mg

Rolinsatamab Biosimilar - Anti-PRLR mAb - Research Grade

Sign In for Pricing
View Details
Human CAT ELISA Kit (Ready to Use)
orb550159-01 48 Tests

Human CAT ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human CAT ELISA Kit (Ready to Use)
orb550159-02 96 Tests

Human CAT ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
RAPGEF4 (Rap Guanine Nucleotide Exchange Factor 4, EPAC, CGEF2, EPAC2, EPAC 2, Nbla00496, CAMP-GEFII) (APC)
MBS6435011-01 0.1 mL

RAPGEF4 (Rap Guanine Nucleotide Exchange Factor 4, EPAC, CGEF2, EPAC2, EPAC 2, Nbla00496, CAMP-GEFII) (APC)

Sign In for Pricing
View Details