Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DZANK1 Rabbit Polyclonal Antibody (HRP)

DZANK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANKRD64, C20orf12, C20orf84

UniProt

Q9NVP4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DZANK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_001092877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKAIN1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1429305 3x 1.0 µg

NKAIN1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cholinergic Receptor, Nicotinic α 7 (CHRNa7) Human ELISA Kit
C3492 96 Tests

Cholinergic Receptor, Nicotinic α 7 (CHRNa7) Human ELISA Kit

Sign In for Pricing
View Details
Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit
MBS7228833-01 48 Well

Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit

Sign In for Pricing
View Details
Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit
MBS7228833-02 96 Well

Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit

Sign In for Pricing
View Details
Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit
MBS7228833-03 5x 96 Well

Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit

Sign In for Pricing
View Details
Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit
MBS7228833-04 10x 96 Well

Rat C-C chemokine receptor-like 2 (CCRL2) ELISA Kit

Sign In for Pricing
View Details