Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGLUCY Rabbit Polyclonal Antibody (HRP)

DGLUCY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf159

UniProt

Q7Z3D6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf159

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

liver FBPase Double Nickase Plasmid (m)
sc-420299-NIC 20 µg

liver FBPase Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rhodopsin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61439R-BF647-01 20 µL

Rhodopsin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rhodopsin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61439R-BF647-02 100 µL

Rhodopsin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SMN2 (Survival Motor Neuron Protein)
492334 100 µL

SMN2 (Survival Motor Neuron Protein)

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTA2) Antibody
abx241049-01 50 µL

Actin Alpha 2, Smooth Muscle (ACTA2) Antibody

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTA2) Antibody
abx241049-02 100 µL

Actin Alpha 2, Smooth Muscle (ACTA2) Antibody

Sign In for Pricing
View Details