Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGLUCY Rabbit Polyclonal Antibody (HRP)

DGLUCY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf159

UniProt

Q7Z3D6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf159

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CORO6 Protein - (Dry Ice)
H00084940-P01-10ug 10 µg

Recombinant Human CORO6 Protein - (Dry Ice)

Sign In for Pricing
View Details
Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit
MBS8803304-01 48 Strip Well

Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit

Sign In for Pricing
View Details
Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit
MBS8803304-02 96 Strip Well

Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit

Sign In for Pricing
View Details
Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit
MBS8803304-03 5x 96 Strip Well

Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit

Sign In for Pricing
View Details
Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit
MBS8803304-04 10x 96 Strip Well

Mouse FABP4 (Fatty Acid Binding Protein 4, Adipocyte) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Serpin C1/Antithrombin-III Antibody (OTI8D5) [Alexa Fluor 405]
NBP2-74113AF405 0.1 mL

Mouse Monoclonal Serpin C1/Antithrombin-III Antibody (OTI8D5) [Alexa Fluor 405]

Sign In for Pricing
View Details