Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr110 Rabbit Polyclonal Antibody (HRP)

Olfr110 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MOR249, MOR249-2

UniProt

A2RT31

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Olfr110

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_666440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT
E6760Hu-01 48 Well

Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT

Sign In for Pricing
View Details
Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT
E6760Hu-02 96 Well

Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT

Sign In for Pricing
View Details
Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT
E6760Hu-03 5x 96 Tests

Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT

Sign In for Pricing
View Details
Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT
E6760Hu-04 10x 96 Tests

Human ATP Synthase Lipid Binding Protein Mithochondrail, ATP5G3 ELISA KIT

Sign In for Pricing
View Details
Fibronectin, Gelatin Binding Domain
F4215-75 100 µg

Fibronectin, Gelatin Binding Domain

Sign In for Pricing
View Details
PAFAH1B2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV662873 1.0 µg DNA

PAFAH1B2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details