Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR75 Rabbit Polyclonal Antibody (Biotin)

WDR75 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NET16, UTP17

UniProt

Q8IWA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR75

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPO Antibody Blocking Peptide
orb1506153 500 µg

TPO Antibody Blocking Peptide

Sign In for Pricing
View Details
RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (PE)
MBS6160084-01 0.1 mL

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (PE)

Sign In for Pricing
View Details
RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (PE)
MBS6160084-02 5x 0.1 mL

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (PE)

Sign In for Pricing
View Details
Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)
MBS1119874-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)

Sign In for Pricing
View Details
Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)
MBS1119874-02 0.1 mg (E-Coli)

Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)

Sign In for Pricing
View Details
Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)
MBS1119874-03 0.02 mg (Yeast)

Recombinant Treponema pallidum subsp. pallidum Flagellar assembly factor FliW (fliW)

Sign In for Pricing
View Details