Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf210 Rabbit Polyclonal Antibody (HRP)

C1orf210 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TEMP

UniProt

Q8IVY1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C1orf210

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVLSLLIALAAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_872323

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sprr4 Mouse Gene Knockout Kit (CRISPR)
KN516666 1 Kit

Sprr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (Y449H, E484K, N501Y), His Tag (MALS verified)
SPD-C5228-1mg 1 mg

SARS-CoV-2 Spike RBD Protein (Y449H, E484K, N501Y), His Tag (MALS verified)

Sign In for Pricing
View Details
OR5AU1 Antibody
8G476-AAT 50 µg

OR5AU1 Antibody

Sign In for Pricing
View Details
NF-H Recombinant Rabbit monoclonal Antibody
HA750357 100 µL

NF-H Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), 1mg/mL
BNUM2288-50 1x 50 µL

SOX9 / SRY-box 9 (rSOX9/2288), 1mg/mL

Sign In for Pricing
View Details
Streptavidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG0STF-SA5/200/W 10x 96 Well Plates

Streptavidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details