Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC13 Rabbit Polyclonal Antibody (HRP)

CCDC13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IYE1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLQFKAMQEMQHKRLQKQMEKKREKELSLKSRADDQEEPLEVSDGLSLLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_653320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-548g-3p miRNA Mimic
MBS8298833-01 5 nmol

hsa-miR-548g-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-548g-3p miRNA Mimic
MBS8298833-02 10 nmol

hsa-miR-548g-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-548g-3p miRNA Mimic
MBS8298833-03 5x 10 nmol

hsa-miR-548g-3p miRNA Mimic

Sign In for Pricing
View Details
Canine Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1) ELISA Kit
GTR10335790 96 Well

Canine Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS525494 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:3 Dihydroorotase (pyrC)
MBS1226736-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype O:3 Dihydroorotase (pyrC)

Sign In for Pricing
View Details