Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTKN2 Rabbit Polyclonal Antibody (HRP)

RTKN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PLEKHK1, bA531F24.1

UniProt

Q8IZC4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RTKN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit
MBS2154736-01 96 Tests

Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit
MBS2154736-02 5x 96 Tests

Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit
MBS2154736-03 10x 96 Tests

Colony Stimulating Factor 1, Macrophage (MCSF) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
4-Hydroxymethyl-4-methyl-1-phenyl-3-pyrazolidinone
278687 100 g

4-Hydroxymethyl-4-methyl-1-phenyl-3-pyrazolidinone

Sign In for Pricing
View Details
UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (APC) discontinued
043503-APC 200 µL

UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (APC) discontinued

Sign In for Pricing
View Details
LtnD Antibody
orb817954 2 mg

LtnD Antibody

Sign In for Pricing
View Details