Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NATD1 Rabbit Polyclonal Antibody (FITC)

NATD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gtlf3b, C17orf103

UniProt

Q8N6N6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf103

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_690878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT5 Protein Vector (Mouse) (pPB-C-His)
PV193122 500 ng

KAT5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NANOS1, ID (NANOS1, NOS1, Nanos homolog 1, EC_Rep1a) (PE) discontinued
038786-PE 200 µL

NANOS1, ID (NANOS1, NOS1, Nanos homolog 1, EC_Rep1a) (PE) discontinued

Sign In for Pricing
View Details
Nardilysin Rabbit Polyclonal Antibody (BF350)
orb2473907 100 µL

Nardilysin Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
AGPAT3 Antibody, Biotin conjugated
A67243-50UG 50 µg

AGPAT3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (AP)
MBS6134855-01 0.1 mL

KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (AP)

Sign In for Pricing
View Details
KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (AP)
MBS6134855-02 5x 0.1 mL

KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (AP)

Sign In for Pricing
View Details