Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF8 Rabbit Polyclonal Antibody (Biotin)

NDUFAF8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MC1DN34, C17orf89

UniProt

A1L188

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf89

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001079990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ErbB3 Antibody Pair Set
E-KAB-0424 50 µL & 100 µg

Human ErbB3 Antibody Pair Set

Sign In for Pricing
View Details
S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF594 conjugate, 0.1mg/mL
BNC942591-500 1x 500 µL

S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody
E-AB-V1053-01 20 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody
E-AB-V1053-02 100 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD10 Antibody[CB-CALLA]
E-AB-F1078Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD10 Antibody[CB-CALLA]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD10 Antibody[CB-CALLA]
E-AB-F1078Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD10 Antibody[CB-CALLA]

Sign In for Pricing
View Details