Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH1 Rabbit Polyclonal Antibody (HRP)

ARMH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P40, C1orf228, NCRNA00082

UniProt

Q6PIY5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C1orf228

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chicken Golgi pH regulator (GPR89), partial
MBS7081784 Inquire

Recombinant Chicken Golgi pH regulator (GPR89), partial

Sign In for Pricing
View Details
AG-825 (Tyrphostin AG-825) 50mg
A24036-50 50 mg

AG-825 (Tyrphostin AG-825) 50mg

Sign In for Pricing
View Details
MTBP (B-5) Alexa Fluor® 790
sc-137201 AF790 200 µg/mL

MTBP (B-5) Alexa Fluor® 790

Sign In for Pricing
View Details
NTHL1 Antibody - middle region
MBS3223279-01 0.1 mL

NTHL1 Antibody - middle region

Sign In for Pricing
View Details
NTHL1 Antibody - middle region
MBS3223279-02 5x 0.1 mL

NTHL1 Antibody - middle region

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Probable beta-glucosidase I (bglI), partial
MBS1475894 Inquire

Recombinant Aspergillus oryzae Probable beta-glucosidase I (bglI), partial

Sign In for Pricing
View Details