Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMH1 Rabbit Polyclonal Antibody (HRP)

ARMH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P40, C1orf228, NCRNA00082

UniProt

Q6PIY5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C1orf228

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K-Ras ligand-Linker Conjugate 3
MBS5770921 Inquire

K-Ras ligand-Linker Conjugate 3

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Calcium-binding mitochondrial carrier SAL1 (SAL1), partial
MBS7059279 Inquire

Recombinant Saccharomyces cerevisiae Calcium-binding mitochondrial carrier SAL1 (SAL1), partial

Sign In for Pricing
View Details
Lentiviral mouse Pkn1 shRNA (UAS) - Lentiviral mouse Pkn1 shRNA (UAS, RFP) (25)
GTR15192107 1 Vial

Lentiviral mouse Pkn1 shRNA (UAS) - Lentiviral mouse Pkn1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human RAB20 shRNA (UAS) - Lentiviral human RAB20 shRNA (UAS, RFP) (100)
GTR15328143 1 Vial

Lentiviral human RAB20 shRNA (UAS) - Lentiviral human RAB20 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
NSUN5C Protein Vector (Human) (pPB-N-His)
PV028962 500 ng

NSUN5C Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Dynlt1f (NM_001166627) Mouse Tagged Lenti ORF Clone
MR214797L4 10 µg

Dynlt1f (NM_001166627) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details