Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSTM5 Rabbit Polyclonal Antibody (FITC)

VSTM5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C11orf90

UniProt

A8MXK1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human VSTM5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human KLRG1/CLEC15A Antibody (SAA0508), APC
FHK27713 100 Tests

Anti-Human KLRG1/CLEC15A Antibody (SAA0508), APC

Sign In for Pricing
View Details
Human DLL3 (176-492) Protein, His Tag (MALS & SPR verified)
DL3-H52Hy-100ug 100 µg

Human DLL3 (176-492) Protein, His Tag (MALS & SPR verified)

Sign In for Pricing
View Details
Mterf2 (NM_001014265) Rat Tagged ORF Clone Lentiviral Particle
RR210378L3V 200 µL

Mterf2 (NM_001014265) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PTPN21 Protein Vector (Mouse) (pPM-C-HA)
PV220888 500 ng

PTPN21 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SMG1, ID (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (MaxLight 490)
MBS6499903-01 0.1 mL

SMG1, ID (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (MaxLight 490)

Sign In for Pricing
View Details
SMG1, ID (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (MaxLight 490)
MBS6499903-02 5x 0.1 mL

SMG1, ID (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (MaxLight 490)

Sign In for Pricing
View Details